SPIRE2 Peptide - N-terminal region
SPIRE2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MGC117166, Spir-2
UniProt
Q8WWL2
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPIRE2 Rabbit Polyclonal Antibody (orb584659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115827
Preservative
Lyophilized powder
AA Sequence
EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470683-500 1x 500 µL
Cytokeratin 7 (OV-TL12/30), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
#33002 1 Kit
Tyramide Amplification Kit with HRP Streptavidin and CF®488A Tyramide
Sign In for Pricing
View Details ![PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI11B2]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907f61/imageurl/cf806811.webp)
CF806811 100 µg
PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI11B2]
Sign In for Pricing
View Details 
BNC881010-500 1x 500 µL
Cytochrome C (CYCS/1010), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details