Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIRE2 Peptide - N-terminal region

SPIRE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC117166, Spir-2

UniProt

Q8WWL2

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPIRE2 Rabbit Polyclonal Antibody (orb584659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115827

Preservative

Lyophilized powder

AA Sequence

EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse CD170 Antibody[S17007L]
AN00629E-01 50 Tests

APC Anti-Mouse CD170 Antibody[S17007L]

Sign In for Pricing
View Details
APC Anti-Mouse CD170 Antibody[S17007L]
AN00629E-02 100 Tests

APC Anti-Mouse CD170 Antibody[S17007L]

Sign In for Pricing
View Details
APC Anti-Mouse CD170 Antibody[S17007L]
AN00629E-03 2x 100 Tests

APC Anti-Mouse CD170 Antibody[S17007L]

Sign In for Pricing
View Details
CF®740 Donkey Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL
#20986-250uL 1x 250 µL

CF®740 Donkey Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501844 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
(R)-(+)-Canadine
TRC-C175170-1G 1 g

(R)-(+)-Canadine

Sign In for Pricing
View Details