Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPR Peptide - C-terminal region

SPR Peptide - C-terminal region

Product Specifications

Product Name Alternative

SDR38C1

UniProt

P35270

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPR Rabbit Polyclonal Antibody (orb584399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003115

Preservative

Lyophilized powder

AA Sequence

ETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ASC1 (TRIP4) activation kit by CRISPRa
GA106215 1 Kit

Human ASC1 (TRIP4) activation kit by CRISPRa

Sign In for Pricing
View Details
Breast Tumor Kinase (Ab-447) Antibody
8B0783-AAT 50 µg

Breast Tumor Kinase (Ab-447) Antibody

Sign In for Pricing
View Details
Piperonyl Butoxide (~90%)
TRC-P490205-5G 5 g

Piperonyl Butoxide (~90%)

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187S-01 50 Tests

Elab Fluor® Red 780 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187S-02 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187S-03 2x 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details