Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPR Peptide - C-terminal region

SPR Peptide - C-terminal region

Product Specifications

Product Name Alternative

SDR38C1

UniProt

P35270

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPR Rabbit Polyclonal Antibody (orb584399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003115

Preservative

Lyophilized powder

AA Sequence

ETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Unknown tissue consistent with ovary
CS715142 5x 5 µm

Tissue FFPE Sections, Unknown tissue consistent with ovary

Sign In for Pricing
View Details
Sp8 Mouse Gene Knockout Kit (CRISPR)
KN516515 1 Kit

Sp8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spsb1 Mouse Gene Knockout Kit (CRISPR)
KN516675 1 Kit

Spsb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GAP43 Rabbit Polyclonal Antibody
AP02772PU-S 50 µL

GAP43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Progesterone Receptor (PGR) Mouse Monoclonal Antibody [Clone ID: OTI16H2]
CF805110 100 µg

Progesterone Receptor (PGR) Mouse Monoclonal Antibody [Clone ID: OTI16H2]

Sign In for Pricing
View Details
EB2 (MAPRE2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F3]
TA502858AM 100 µL

EB2 (MAPRE2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F3]

Sign In for Pricing
View Details