SPRY4 Peptide - middle region
SPRY4 Peptide - middle region
Product Specifications
UniProt
Q9C004
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPRY4 Rabbit Polyclonal Antibody (orb581180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112226
Preservative
Lyophilized powder
AA Sequence
LCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSV030245 100 µg
Recombinant Rift Valley fever virus (RVFV) (strain MP12) glycoprotein / G1 Protein (His Tag)
Sign In for Pricing
View Details 
BNC941970-500 1x 500 µL
Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB2552-500 1x 500 µL
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Elab Fluor® 700 Anti-Human HLA-A, B, C Antibody[W6/32]](https://cdn.genprice.uk/products/763/68dd14af061270361e7d36fd/imageurl/e-ab-f1130m1.webp)
E-AB-F1130M1-01 20 Tests
Elab Fluor® 700 Anti-Human HLA-A, B, C Antibody[W6/32]
Sign In for Pricing
View Details