Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRY4 Peptide - middle region

SPRY4 Peptide - middle region

Product Specifications

UniProt

Q9C004

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPRY4 Rabbit Polyclonal Antibody (orb581180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112226

Preservative

Lyophilized powder

AA Sequence

LCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIB2 Antibody
8C10194-AAT 50 µg

CIB2 Antibody

Sign In for Pricing
View Details
(S)-Ethyl 2,6-Diisocyanatohexanoate
TRC-E937178-500MG 500 mg

(S)-Ethyl 2,6-Diisocyanatohexanoate

Sign In for Pricing
View Details
Recombinant Human GAPDH Protein (His Tag)
PKSH031882 100 µg

Recombinant Human GAPDH Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS505977 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
c-Jun (JUN) Rabbit Polyclonal Antibody
AP06059PU-N 100 µg

c-Jun (JUN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Galectin 1 Recombinant Rabbit monoclonal Antibody [JM13-37]
ET1705-83-50UL 50 µL

Galectin 1 Recombinant Rabbit monoclonal Antibody [JM13-37]

Sign In for Pricing
View Details