Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRYD3 Peptide - N-terminal region

SPRYD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ14800

UniProt

Q8NCJ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPRYD3 Rabbit Polyclonal Antibody (orb584759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116229

Preservative

Lyophilized powder

AA Sequence

LVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKGRQFGSKCNSGDRIGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vanillic Acid 4-Sulphate Sodium Salt
TRC-S712350-50MG 50 mg

Vanillic Acid 4-Sulphate Sodium Salt

Sign In for Pricing
View Details
Recombinant Mouse TFPI Protein (His Tag)
PKSM040845 50 µg

Recombinant Mouse TFPI Protein (His Tag)

Sign In for Pricing
View Details
WDR43 Human Gene Knockout Kit (CRISPR)
KN426083 1 Kit

WDR43 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB544810 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
2,4-Diamino-7-hydroxy-6-pteridineacetic Acid Ethyl Ester
TRC-D416460-10MG 10 mg

2,4-Diamino-7-hydroxy-6-pteridineacetic Acid Ethyl Ester

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3194), CF647 conjugate, 0.1mg/mL
BNC473194-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3194), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details