SPSB2 Peptide - N-terminal region
SPSB2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ17395, GRCC9, MGC2519, SSB2
UniProt
Q99619
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPSB2 Rabbit Polyclonal Antibody (orb326358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IHC, WB
NCBI Accession Number
NP_116030
Preservative
Lyophilized powder
AA Sequence
KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041527-500 1x 500 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB2808-500 1x 500 µL
Cytokeratin 18 (KRT18) (KRT18/2808R), 0.2mg/mL
Sign In for Pricing
View Details 
LC401911 20 µg
TADA3L (TADA3) (NM_006354) Human Over-expression Lysate
Sign In for Pricing
View Details 
AP09471PU-N 100 µL
JNK1 (MAPK8) pThr183/pTyr185 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details ![[SP-4-2-(1R-trans)]-(1,2-Cyclohexanediamine-κN,κN') Diiodoplatinum](https://cdn.genprice.uk/products/572/7046386559010/imageurl/trc-c984525-250mg.webp)
TRC-C984525-250MG 250 mg
[SP-4-2-(1R-trans)]-(1,2-Cyclohexanediamine-κN,κN') Diiodoplatinum
Sign In for Pricing
View Details 