Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPSB2 Peptide - N-terminal region

SPSB2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ17395, GRCC9, MGC2519, SSB2

UniProt

Q99619

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPSB2 Rabbit Polyclonal Antibody (orb326358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_116030

Preservative

Lyophilized powder

AA Sequence

KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS8 Antibody
KC-29218-01 50 μL

VPS8 Antibody

Sign In for Pricing
View Details
VPS8 Antibody
KC-29218-02 100 µL

VPS8 Antibody

Sign In for Pricing
View Details
VPS8 Antibody
KC-29218-03 1 mL

VPS8 Antibody

Sign In for Pricing
View Details
CD57 / B3GAT1 (HNK-1), 0.2mg/mL
BNUB0136-500 1x 500 µL

CD57 / B3GAT1 (HNK-1), 0.2mg/mL

Sign In for Pricing
View Details
Mouse Bcl6b activation kit by CRISPRa
GA200372 1 Kit

Mouse Bcl6b activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR562784 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details