Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SQOR Peptide - middle region

SQOR Peptide - middle region

Product Specifications

Product Name Alternative

SQR, SQRDL, CGI-44, PRO1975

UniProt

Q9Y6N5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SQOR Rabbit Polyclonal Antibody (orb585406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067022

Preservative

Lyophilized powder

AA Sequence

MYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) Mouse Monoclonal Antibody
MBS439682-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) Mouse Monoclonal Antibody
MBS439682-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) Mouse Monoclonal Antibody
MBS439682-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) Mouse Monoclonal Antibody
MBS439682-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) Mouse Monoclonal Antibody
MBS439682-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Stathmin 1 (STMN1) (NM_203401) Human Over-expression Lysate
LY404340 100 µg

Stathmin 1 (STMN1) (NM_203401) Human Over-expression Lysate

Sign In for Pricing
View Details