Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRA1 Peptide - middle region

SRA1 Peptide - middle region

Product Specifications

Product Name Alternative

MGC87674, SRA, SRAP, STRAA1, pp7684

UniProt

Q9HD15

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRA1 Rabbit Polyclonal Antibody (orb331146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001030312

Preservative

Lyophilized powder

AA Sequence

SGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lambda Antibody : AP
OASB00204-1ML 1.0 mL

Mouse Lambda Antibody : AP

Sign In for Pricing
View Details
SCG2 Rabbit pAb
E45R26518N-100 100 µL

SCG2 Rabbit pAb

Sign In for Pricing
View Details
Human DNA polymerase subunit gamma-1, POLG ELISA KIT
ELI-27686h 96 Tests

Human DNA polymerase subunit gamma-1, POLG ELISA KIT

Sign In for Pricing
View Details
MAP3K3 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV623520 1.0 µg DNA

MAP3K3 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
MCM7 Antibody
58-402 400 µL

MCM7 Antibody

Sign In for Pricing
View Details
CENPB Rabbit Polyclonal Antibody (FITC)
orb2110029 100 µL

CENPB Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details