SRA1 Peptide - middle region
SRA1 Peptide - middle region
Product Specifications
Product Name Alternative
MGC87674, SRA, SRAP, STRAA1, pp7684
UniProt
Q9HD15
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SRA1 Rabbit Polyclonal Antibody (orb331146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001030312
Preservative
Lyophilized powder
AA Sequence
SGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
132969-ML650 100 µL
SAP30 (Sin3-associated Polypeptide p30, 30kD Sin3-associated Polypeptide, Histone Deacetylase Complex Subunit SAP30, Sin3 Corepressor Complex Subunit SAP30) (MaxLight 650)
Sign In for Pricing
View Details 
bs-4901R-PerCP-Cy5.5 100 µL
Annexin A7 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
Sign In for Pricing
View Details