Sra1 Peptide - N-terminal region
Sra1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AA959952, SRA, STRAA1, Strra1, Sra, Srap, Straa1
UniProt
Q80VJ2
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Sra1 Rabbit Polyclonal Antibody (orb329918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079567
Preservative
Lyophilized powder
AA Sequence
MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401703-100 1x 100 µL
PAX8 (Renal Cell Marker) (PAX8/1491 + PAX8/1492), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC321284-500 1x 500 µL
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF532 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![BTG1 Mouse Monoclonal Antibody [Clone ID: OTI7H6]](https://cdn.genprice.uk/products/937/68dd18b9061270361e9081ba/imageurl/cf807834.webp)
BNC681485-100 1x 100 µL
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681902-500 1x 500 µL
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details