Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sra1 Peptide - N-terminal region

Sra1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AA959952, SRA, STRAA1, Strra1, Sra, Srap, Straa1

UniProt

Q80VJ2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sra1 Rabbit Polyclonal Antibody (orb329918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079567

Preservative

Lyophilized powder

AA Sequence

MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MANF Antibody
KC-3390-01 50 μL

MANF Antibody

Sign In for Pricing
View Details
MANF Antibody
KC-3390-02 100 µL

MANF Antibody

Sign In for Pricing
View Details
MANF Antibody
KC-3390-03 1 mL

MANF Antibody

Sign In for Pricing
View Details
GPR65 (NM_003608) Human Over-expression Lysate
LY401195 100 µg

GPR65 (NM_003608) Human Over-expression Lysate

Sign In for Pricing
View Details
Spiroxamine-d4
TRC-S683502-1MG 1 mg

Spiroxamine-d4

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), CF405S conjugate, 0.1mg/mL
BNC041423-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details