Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRC Peptide - N-terminal region

SRC Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASV, SRC1, c-SRC, p60-Src

UniProt

P12931

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005408

Preservative

Lyophilized powder

AA Sequence

QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDCA-2 Protein, Cynomolgus, Recombinant (hFc)
TMPK-00504-01 5 µg

BDCA-2 Protein, Cynomolgus, Recombinant (hFc)

Sign In for Pricing
View Details
BDCA-2 Protein, Cynomolgus, Recombinant (hFc)
TMPK-00504-02 10 µg

BDCA-2 Protein, Cynomolgus, Recombinant (hFc)

Sign In for Pricing
View Details
BDCA-2 Protein, Cynomolgus, Recombinant (hFc)
TMPK-00504-03 20 µg

BDCA-2 Protein, Cynomolgus, Recombinant (hFc)

Sign In for Pricing
View Details
BDCA-2 Protein, Cynomolgus, Recombinant (hFc)
TMPK-00504-04 50 µg

BDCA-2 Protein, Cynomolgus, Recombinant (hFc)

Sign In for Pricing
View Details
BDCA-2 Protein, Cynomolgus, Recombinant (hFc)
TMPK-00504-05 100 µg

BDCA-2 Protein, Cynomolgus, Recombinant (hFc)

Sign In for Pricing
View Details
BDCA-2 Protein, Cynomolgus, Recombinant (hFc)
TMPK-00504-06 200 µg

BDCA-2 Protein, Cynomolgus, Recombinant (hFc)

Sign In for Pricing
View Details