Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRD5A2 Peptide - N-terminal region

SRD5A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC138457

UniProt

P31213

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRD5A2 Rabbit Polyclonal Antibody (orb330377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000339

Preservative

Lyophilized powder

AA Sequence

KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Syncoilin ELISA Kit
MBS086755-01 48 Well

Camel Syncoilin ELISA Kit

Sign In for Pricing
View Details
Camel Syncoilin ELISA Kit
MBS086755-02 96 Well

Camel Syncoilin ELISA Kit

Sign In for Pricing
View Details
Camel Syncoilin ELISA Kit
MBS086755-03 5x 96 Well

Camel Syncoilin ELISA Kit

Sign In for Pricing
View Details
Camel Syncoilin ELISA Kit
MBS086755-04 10x 96 Well

Camel Syncoilin ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-PITX-1 antibody
SL4483R-01 50 µL

Rabbit Anti-PITX-1 antibody

Sign In for Pricing
View Details
Rabbit Anti-PITX-1 antibody
SL4483R-02 100 µL

Rabbit Anti-PITX-1 antibody

Sign In for Pricing
View Details