Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRD5A2 Peptide - N-terminal region

SRD5A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC138457

UniProt

P31213

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRD5A2 Rabbit Polyclonal Antibody (orb330377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000339

Preservative

Lyophilized powder

AA Sequence

KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urethane
sc-213134B 25 g

Urethane

Sign In for Pricing
View Details
Lentiviral mouse Oasl1 shRNA (UAS) - Lentiviral mouse Oasl1 shRNA (UAS, iRFP) (100)
GTR15245583 1 Vial

Lentiviral mouse Oasl1 shRNA (UAS) - Lentiviral mouse Oasl1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human SPINK9 shRNA Plasmid
abx968454-01 150 µg

Human SPINK9 shRNA Plasmid

Sign In for Pricing
View Details
Human SPINK9 shRNA Plasmid
abx968454-02 300 µg

Human SPINK9 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal Protein phosphatase 1F Antibody
NBP3-35535-20ul 20 µL

Rabbit Polyclonal Protein phosphatase 1F Antibody

Sign In for Pricing
View Details
Rat Monoclonal B220/CD45R Antibody (RM0063-9F14) [DyLight 680]
NBP2-12168FR 0.1 mL

Rat Monoclonal B220/CD45R Antibody (RM0063-9F14) [DyLight 680]

Sign In for Pricing
View Details