Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRI Peptide - middle region

SRI Peptide - middle region

Product Specifications

Product Name Alternative

FLJ26259, SCN, CP22

UniProt

P30626

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRI Rabbit Polyclonal Antibody (orb585490) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003121

Preservative

Lyophilized powder

AA Sequence

KELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF6 Antibody (N-term) Blocking Peptide
MBS9220931-01 0.5 mg

TAF6 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
TAF6 Antibody (N-term) Blocking Peptide
MBS9220931-02 5x 0.5 mg

TAF6 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Anti-CDKN1B Antibody (R1W78)
RHE48201 100 μg

Anti-CDKN1B Antibody (R1W78)

Sign In for Pricing
View Details
DPP6 Polyclonal Conjugated Antibody
MBS9439219-01 0.1 mL (Biotin)

DPP6 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DPP6 Polyclonal Conjugated Antibody
MBS9439219-02 0.1 mL (AF350)

DPP6 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DPP6 Polyclonal Conjugated Antibody
MBS9439219-03 0.1 mL (AF405)

DPP6 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details