Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRI Peptide - middle region

SRI Peptide - middle region

Product Specifications

Product Name Alternative

FLJ26259, SCN, CP22

UniProt

P30626

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRI Rabbit Polyclonal Antibody (orb585490) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003121

Preservative

Lyophilized powder

AA Sequence

KELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIPC3 Polyclonal Antibody, APC Conjugated
bs-16246R-APC 100 µL

GIPC3 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
EDD Rabbit mAb
E60M3384 100 µL

EDD Rabbit mAb

Sign In for Pricing
View Details
N, N-Diethyl-m-toluamide 95%
D24970-01 100 g

N, N-Diethyl-m-toluamide 95%

Sign In for Pricing
View Details
N, N-Diethyl-m-toluamide 95%
D24970-02 500 g

N, N-Diethyl-m-toluamide 95%

Sign In for Pricing
View Details
AKR7A2 Mouse mAb
orb2714278-01 50 µL

AKR7A2 Mouse mAb

Sign In for Pricing
View Details
AKR7A2 Mouse mAb
orb2714278-02 100 µL

AKR7A2 Mouse mAb

Sign In for Pricing
View Details