Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRI Peptide - C-terminal region

SRI Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ26259, SCN, CP22

UniProt

P30626

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRI Rabbit Polyclonal Antibody (orb585491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003121

Preservative

Lyophilized powder

AA Sequence

QAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC12A6 siRNA (Human)
MBS8201450-01 15 nmol

SLC12A6 siRNA (Human)

Sign In for Pricing
View Details
SLC12A6 siRNA (Human)
MBS8201450-02 30 nmol

SLC12A6 siRNA (Human)

Sign In for Pricing
View Details
SLC12A6 siRNA (Human)
MBS8201450-03 5x 30 nmol

SLC12A6 siRNA (Human)

Sign In for Pricing
View Details
NaS-1 HDR Plasmid (m)
sc-424953-HDR 20 µg

NaS-1 HDR Plasmid (m)

Sign In for Pricing
View Details
Human IFN-α High Sensitivity ELISA Kit
E28L0707 96 Tests

Human IFN-α High Sensitivity ELISA Kit

Sign In for Pricing
View Details
Anti-EIF4EL3  (1F3)
YF-MA16862 100 ug

Anti-EIF4EL3 (1F3)

Sign In for Pricing
View Details