Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRI Peptide - C-terminal region

SRI Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ26259, SCN, CP22

UniProt

P30626

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRI Rabbit Polyclonal Antibody (orb585491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003121

Preservative

Lyophilized powder

AA Sequence

QAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD42 Protein Vector (Human) (pPB-His-GST)
PV322147 500 ng

ANKRD42 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Human anti-human CD63 mAb (T59)
E4A09C14-T59 100 µg

Human anti-human CD63 mAb (T59)

Sign In for Pricing
View Details
JNK1 (MAPK8) Rabbit Polyclonal Antibody
TA325662 100 µL

JNK1 (MAPK8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BMS1P4 3'UTR Lenti-reporter-Luc Vector
13384081 1.0 µg

BMS1P4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human CSRNP1 Pre-designed siRNA Set A
SI003713A 1 Each

Human CSRNP1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Biotinylated Anti-IL-6 antibody (DMC419) ; IgG1 Chimeric mAb
12-9413B-10 10 µg

Biotinylated Anti-IL-6 antibody (DMC419) ; IgG1 Chimeric mAb

Sign In for Pricing
View Details