Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRL Peptide - C-terminal region

SRL Peptide - C-terminal region

Product Specifications

UniProt

Q86TD4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRL Rabbit Polyclonal Antibody (orb326459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092284

Preservative

Lyophilized powder

AA Sequence

QMLMRVYGALFWSLAPLINVTEPPRVYVSSFWPQEYKPDTHQELFLQEEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP8A Antibody
8C14766-AAT 50 µg

BMP8A Antibody

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon: right
CD564456 5 µg

Tissue Genomic DNA, Colon: right

Sign In for Pricing
View Details
Recombinant Mouse ANPEP/CD13 Protein (His Tag)
PKSM040927 50 µg

Recombinant Mouse ANPEP/CD13 Protein (His Tag)

Sign In for Pricing
View Details
Septin 3 (SEPT3) Mouse Monoclonal Antibody [Clone ID: OTI1D10]
CF811204 100 µg

Septin 3 (SEPT3) Mouse Monoclonal Antibody [Clone ID: OTI1D10]

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/3137R), CF488A conjugate, 0.1mg/mL
BNC883137-500 1x 500 µL

MTAP (Tumor Suppressor Marker) (MTAP/3137R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/795), CF640R conjugate, 0.1mg/mL
BNC400795-500 1x 500 µL

CD56 / NCAM (NCAM1/795), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details