Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRP54A Peptide - C-terminal region

SRP54A Peptide - C-terminal region

Product Specifications

Product Name Alternative

Srp54

UniProt

Q6AYB5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRP54A Rabbit Polyclonal Antibody (orb324861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446323

Preservative

Lyophilized powder

AA Sequence

DGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REST Recombinant Rabbit Monoclonal Antibody [JE32-25]
HA720081 100 µL

REST Recombinant Rabbit Monoclonal Antibody [JE32-25]

Sign In for Pricing
View Details
Quercetin 3-O-(6''-O-Malonyl)-b-D-glucoside
TRC-Q510035-1MG 1 mg

Quercetin 3-O-(6''-O-Malonyl)-b-D-glucoside

Sign In for Pricing
View Details
Myeloid leukemia factor 1 (mLF1) (NM_001195432) Human Over-expression Lysate
LC434142 20 µg

Myeloid leukemia factor 1 (mLF1) (NM_001195432) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Endometrium
CB600201 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR562688 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Stathmin 1 (STMN1) (NM_005563) Human Recombinant Protein
TP313958L 1 mg

Stathmin 1 (STMN1) (NM_005563) Human Recombinant Protein

Sign In for Pricing
View Details