Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRP54A Peptide - C-terminal region

SRP54A Peptide - C-terminal region

Product Specifications

Product Name Alternative

Srp54

UniProt

Q6AYB5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRP54A Rabbit Polyclonal Antibody (orb324861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446323

Preservative

Lyophilized powder

AA Sequence

DGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(KO Validated) IGF1R Polyclonal Antibody
E-AB-68249-01 60 µL

(KO Validated) IGF1R Polyclonal Antibody

Sign In for Pricing
View Details
(KO Validated) IGF1R Polyclonal Antibody
E-AB-68249-02 120 µL

(KO Validated) IGF1R Polyclonal Antibody

Sign In for Pricing
View Details
(KO Validated) IGF1R Polyclonal Antibody
E-AB-68249-03 200 µL

(KO Validated) IGF1R Polyclonal Antibody

Sign In for Pricing
View Details
Prion protein PrP (PRNP) Human Gene Knockout Kit (CRISPR)
KN401921 1 Kit

Prion protein PrP (PRNP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS702033 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
MYD88 Rabbit Polyclonal Antibody
AP02277SU-S 20 µL

MYD88 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details