SRR Peptide - middle region
SRR Peptide - middle region
Product Specifications
Product Name Alternative
ILV1, ISO1
UniProt
Q9GZT4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SRR Rabbit Polyclonal Antibody (orb583618) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_068766
Preservative
Lyophilized powder
AA Sequence
GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HP228894 200 Reactions
Staufen (STAU1) Human qPCR Primer Pair (NM_017453)
Sign In for Pricing
View Details 
MBS6276172-01 0.2 mL
ATG4D, NT (ATG4D, APG4D, AUTL4, Cysteine protease ATG4D, AUT-like 4 cysteine endopeptidase, Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D) (AP)
Sign In for Pricing
View Details MBS6276172-02 5x 0.2 mL
ATG4D, NT (ATG4D, APG4D, AUTL4, Cysteine protease ATG4D, AUT-like 4 cysteine endopeptidase, Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D) (AP)
Sign In for Pricing
View Details orb2851610 100 µL
Phospho-mTOR (Thr2446) Rabbit pAb, Pacific Blue conjugated
Sign In for Pricing
View Details orb780587-01 48 Tests
Mouse Adrenergic Receptor Beta 3 (ADRb3) ELISA Kit
Sign In for Pricing
View Details orb780587-02 96 Tests
Mouse Adrenergic Receptor Beta 3 (ADRb3) ELISA Kit
Sign In for Pricing
View Details