Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Srrm1 Peptide - C-terminal region

Srrm1 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Srrm1 Rabbit Polyclonal Antibody (orb577686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101456

Preservative

Lyophilized powder

AA Sequence

PSPVQSQSPSTNWSPAAPAKKAKSPTPSPSPARNSDQEGGGKKKKKKKDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADM2 3'UTR Lenti-reporter-Luc Vector
11430081 1.0 µg

ADM2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Anti-Human PIGR Nanobody (SAA1311)
HF948013-01 50 µg

Anti-Human PIGR Nanobody (SAA1311)

Sign In for Pricing
View Details
Anti-Human PIGR Nanobody (SAA1311)
HF948013-02 100 µg

Anti-Human PIGR Nanobody (SAA1311)

Sign In for Pricing
View Details
Anti-Human PIGR Nanobody (SAA1311)
HF948013-03 1 mg

Anti-Human PIGR Nanobody (SAA1311)

Sign In for Pricing
View Details
Prokaryotic Mouse Lymphatic Vessel Endothelial Hyaluronan Receptor 1
RPU60871-01 50 µg

Prokaryotic Mouse Lymphatic Vessel Endothelial Hyaluronan Receptor 1

Sign In for Pricing
View Details
Prokaryotic Mouse Lymphatic Vessel Endothelial Hyaluronan Receptor 1
RPU60871-02 100 µg

Prokaryotic Mouse Lymphatic Vessel Endothelial Hyaluronan Receptor 1

Sign In for Pricing
View Details