Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Srrm1 Peptide - C-terminal region

Srrm1 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Srrm1 Rabbit Polyclonal Antibody (orb577686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101456

Preservative

Lyophilized powder

AA Sequence

PSPVQSQSPSTNWSPAAPAKKAKSPTPSPSPARNSDQEGGGKKKKKKKDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP21 Antibody, Biotin conjugated
A68822-50UG 50 µg

DUSP21 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MTHFR (Methylenetetrahydrofolate Reductase) (MaxLight 650)
MBS6386113-01 0.1 mL

MTHFR (Methylenetetrahydrofolate Reductase) (MaxLight 650)

Sign In for Pricing
View Details
MTHFR (Methylenetetrahydrofolate Reductase) (MaxLight 650)
MBS6386113-02 5x 0.1 mL

MTHFR (Methylenetetrahydrofolate Reductase) (MaxLight 650)

Sign In for Pricing
View Details
LASS4 (LAG1 Homolog, Ceramide Synthase 4, CerS4, FLJ12089, Trh1) (MaxLight 405)
MBS6196438-01 0.1 mL

LASS4 (LAG1 Homolog, Ceramide Synthase 4, CerS4, FLJ12089, Trh1) (MaxLight 405)

Sign In for Pricing
View Details
LASS4 (LAG1 Homolog, Ceramide Synthase 4, CerS4, FLJ12089, Trh1) (MaxLight 405)
MBS6196438-02 5x 0.1 mL

LASS4 (LAG1 Homolog, Ceramide Synthase 4, CerS4, FLJ12089, Trh1) (MaxLight 405)

Sign In for Pricing
View Details
Phospho-ETS1 (Thr38) Rabbit Polyclonal Antibody
orb156790-01 50 μL

Phospho-ETS1 (Thr38) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details