Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ssr2 Peptide - C-terminal region

Ssr2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1500032E05Rik, AI315033, AU020133, TLAP, TRAPB, TRAPbeta

UniProt

Q9CPW5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ssr2 Rabbit Polyclonal Antibody (orb579459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079724

Preservative

Lyophilized powder

AA Sequence

KAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blood Group Antigen B (CD173) (HEB-20), CF405S conjugate, 0.1mg/mL
BNC040296-500 1x 500 µL

Blood Group Antigen B (CD173) (HEB-20), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Chloro-4-ethylpyridine
TRC-C366220-1G 1 g

2-Chloro-4-ethylpyridine

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), 1mg/mL
BNUM0737-50 1x 50 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), 1mg/mL

Sign In for Pricing
View Details
DBF4 (NM_006716) Human Over-expression Lysate
LC402007 20 µg

DBF4 (NM_006716) Human Over-expression Lysate

Sign In for Pricing
View Details
LONP2 (N-term) Rabbit Polyclonal Antibody
AP52512PU-N 400 µL

LONP2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R3A (NM_002711) Human Over-expression Lysate
LC419154 20 µg

PPP1R3A (NM_002711) Human Over-expression Lysate

Sign In for Pricing
View Details