Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ssr2 Peptide - C-terminal region

Ssr2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1500032E05Rik, AI315033, AU020133, TLAP, TRAPB, TRAPbeta

UniProt

Q9CPW5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ssr2 Rabbit Polyclonal Antibody (orb579459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079724

Preservative

Lyophilized powder

AA Sequence

KAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant c-Jun (phospho S63) Antibody
RC-4154-01 50 μL

Recombinant c-Jun (phospho S63) Antibody

Sign In for Pricing
View Details
Recombinant c-Jun (phospho S63) Antibody
RC-4154-02 100 µL

Recombinant c-Jun (phospho S63) Antibody

Sign In for Pricing
View Details
Recombinant c-Jun (phospho S63) Antibody
RC-4154-03 1 mL

Recombinant c-Jun (phospho S63) Antibody

Sign In for Pricing
View Details
TMEM212 (NM_001164436) Human Over-expression Lysate
LC431152 20 µg

TMEM212 (NM_001164436) Human Over-expression Lysate

Sign In for Pricing
View Details
Ketotifen N-Oxide Hydrochloride
TRC-K315410-50MG 50 mg

Ketotifen N-Oxide Hydrochloride

Sign In for Pricing
View Details
Human TLR-2 (Toll-like Receptor 2) ELISA Kit
E-EL-H0951-01 24 Tests

Human TLR-2 (Toll-like Receptor 2) ELISA Kit

Sign In for Pricing
View Details