Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSTR5 Peptide - C-terminal region

SSTR5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SS-5-R

UniProt

P35346

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001044

Preservative

Lyophilized powder

AA Sequence

PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPT / TAU Rabbit Polyclonal Antibody
AP06342PU-N 100 µg

MAPT / TAU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human C8orf74 activation kit by CRISPRa
GA116431 1 Kit

Human C8orf74 activation kit by CRISPRa

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (CDH16/1071), CF740 conjugate, 0.1mg/mL
BNC741071-500 1x 500 µL

Ksp-Cadherin / CDH16 (CDH16/1071), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PIWIL2 (NM_001135721) Human Over-expression Lysate
LC427682 20 µg

PIWIL2 (NM_001135721) Human Over-expression Lysate

Sign In for Pricing
View Details
b-Chloro-D-alanine Hydrochloride
TRC-C364200-250MG 250 mg

b-Chloro-D-alanine Hydrochloride

Sign In for Pricing
View Details
HSP90 Beta Recombinant Mouse Monoclonal Antibody [2-1-G3-R]
HA601176 100 µL

HSP90 Beta Recombinant Mouse Monoclonal Antibody [2-1-G3-R]

Sign In for Pricing
View Details