Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSTR5 Peptide - C-terminal region

SSTR5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SS-5-R

UniProt

P35346

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001044

Preservative

Lyophilized powder

AA Sequence

PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS808166 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
PHOS / PDC Recombinant Rabbit monoclonal Antibody
HA723116 100 µL

PHOS / PDC Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TPK1 (NM_001042482) Human Over-expression Lysate
LC420935 20 µg

TPK1 (NM_001042482) Human Over-expression Lysate

Sign In for Pricing
View Details
Flavopiridol Hydrochloride
TRC-F373000-50MG 50 mg

Flavopiridol Hydrochloride

Sign In for Pricing
View Details
MAP4K2 Polyclonal Antibody
E-AB-14677-01 20 µL

MAP4K2 Polyclonal Antibody

Sign In for Pricing
View Details
MAP4K2 Polyclonal Antibody
E-AB-14677-02 60 µL

MAP4K2 Polyclonal Antibody

Sign In for Pricing
View Details