Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX3 Peptide - N-terminal region

SSX3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT5.3, MGC119054, MGC14495

UniProt

Q7RTT3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066294

Preservative

Lyophilized powder

AA Sequence

LCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL4I1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
24894062 1.0 µg DNA

IL4I1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Defensin Alpha 3, Neutrophil Specific (DEFa3) ELISA Kit
YLA3099HU-01 48 Tests

Human Defensin Alpha 3, Neutrophil Specific (DEFa3) ELISA Kit

Sign In for Pricing
View Details
Human Defensin Alpha 3, Neutrophil Specific (DEFa3) ELISA Kit
YLA3099HU-02 96 Tests

Human Defensin Alpha 3, Neutrophil Specific (DEFa3) ELISA Kit

Sign In for Pricing
View Details
Cldn23 (NM_027998) Mouse Tagged Lenti ORF Clone
MR204097L3 10 µg

Cldn23 (NM_027998) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human hsa-miR-4272 miRNA Agomir
abx881063-01 5 nmol

Human hsa-miR-4272 miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-4272 miRNA Agomir
abx881063-02 10 nmol

Human hsa-miR-4272 miRNA Agomir

Sign In for Pricing
View Details