Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX4B Peptide - middle region

SSX4B Peptide - middle region

Product Specifications

Product Name Alternative

SSX4, CT5.4

UniProt

O60224

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SSX4B Rabbit Polyclonal Antibody (orb325577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001030004

Preservative

Lyophilized powder

AA Sequence

MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kcnh2 Pre-designed siRNA Set A
SI107033A 1 Each

Mouse Kcnh2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
WDR5 Antibody (C-term) [APR32971G]
APR32971G-01 50 µL

WDR5 Antibody (C-term) [APR32971G]

Sign In for Pricing
View Details
WDR5 Antibody (C-term) [APR32971G]
APR32971G-02 100 µL

WDR5 Antibody (C-term) [APR32971G]

Sign In for Pricing
View Details
WDR5 Antibody (C-term) [APR32971G]
APR32971G-03 200 µL

WDR5 Antibody (C-term) [APR32971G]

Sign In for Pricing
View Details
WDR5 Antibody (C-term) [APR32971G]
APR32971G-04 400 µL

WDR5 Antibody (C-term) [APR32971G]

Sign In for Pricing
View Details
Anti-KLF12  (3E4)
YF-MA17701 100 ug

Anti-KLF12 (3E4)

Sign In for Pricing
View Details