Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX4B Peptide - middle region

SSX4B Peptide - middle region

Product Specifications

Product Name Alternative

SSX4, CT5.4

UniProt

O60224

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SSX4B Rabbit Polyclonal Antibody (orb325577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001030004

Preservative

Lyophilized powder

AA Sequence

MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HES7 ORF Vector (Human) (pORF)
23219011 1.0 µg DNA

HES7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
VCP Conjugated Antibody
orb1611583 100 µL

VCP Conjugated Antibody

Sign In for Pricing
View Details
CSPG4 Conjugated Antibody
MBS9452194-01 0.1 mL (Biotin)

CSPG4 Conjugated Antibody

Sign In for Pricing
View Details
CSPG4 Conjugated Antibody
MBS9452194-02 0.1 mL (AF350)

CSPG4 Conjugated Antibody

Sign In for Pricing
View Details
CSPG4 Conjugated Antibody
MBS9452194-03 0.1 mL (AF405)

CSPG4 Conjugated Antibody

Sign In for Pricing
View Details
CSPG4 Conjugated Antibody
MBS9452194-04 0.1 mL (AF488)

CSPG4 Conjugated Antibody

Sign In for Pricing
View Details