Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

St6gal2 Peptide - C-terminal region

St6gal2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C230064G14Rik, St6galII, mKIAA1877

UniProt

B2RQY9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with St6gal2 Rabbit Polyclonal Antibody (orb580972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766417

Preservative

Lyophilized powder

AA Sequence

RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Bromonaphthalene-d7
TRC-B685902-1G 1 g

1-Bromonaphthalene-d7

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS701778 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
HABP2 Mouse Monoclonal Antibody [Clone ID: OTI4G9]
CF809397 100 µg

HABP2 Mouse Monoclonal Antibody [Clone ID: OTI4G9]

Sign In for Pricing
View Details
Dematin (DMTN) (NM_001114139) Human Over-expression Lysate
LC426467 20 µg

Dematin (DMTN) (NM_001114139) Human Over-expression Lysate

Sign In for Pricing
View Details
Tmem186 Mouse Gene Knockout Kit (CRISPR)
KN517776 1 Kit

Tmem186 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Platinum On Carbon (10 wt. %)
TRC-P578005-5G 5 g

Platinum On Carbon (10 wt. %)

Sign In for Pricing
View Details