St6gal2 Peptide - C-terminal region
St6gal2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C230064G14Rik, St6galII, mKIAA1877
UniProt
B2RQY9
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with St6gal2 Rabbit Polyclonal Antibody (orb580972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_766417
Preservative
Lyophilized powder
AA Sequence
RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BCBT-102 Each
Weak acid and alkali Chemical storage cabinet BCBT-102
Sign In for Pricing
View Details ![WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc3c2/imageurl/am09053pu-n.webp)
![Phospho-Tau (S202) Recombinant Rabbit Monoclonal Antibody [JE66-81]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82845/imageurl/ha721666.webp)
HA721666 100 µL
Phospho-Tau (S202) Recombinant Rabbit Monoclonal Antibody [JE66-81]
Sign In for Pricing
View Details 
