Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAM Peptide - N-terminal region

STAM Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686J2352, STAM1, STAM-1

UniProt

Q92783

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAM Rabbit Polyclonal Antibody (orb585528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003464

Preservative

Lyophilized powder

AA Sequence

EQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit
YLA0190CH-01 48 Tests

Chicken B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit

Sign In for Pricing
View Details
Chicken B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit
YLA0190CH-02 96 Tests

Chicken B-cell leukemia/lymphoma 2, Bcl-2 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Acyl coenzyme A synthetase ACSM6, mitochondrial (C10orf129) ELISA Kit
GTR10342920 96 Well

Guinea Pig Acyl coenzyme A synthetase ACSM6, mitochondrial (C10orf129) ELISA Kit

Sign In for Pricing
View Details
CCDC90AP1 Protein Lysate (Human) with C-Ha Tag
15328031 100 µg

CCDC90AP1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Human Endothelin 1 ELISA Kit
MBS8410884-01 1 Kit

Human Endothelin 1 ELISA Kit

Sign In for Pricing
View Details
Human Endothelin 1 ELISA Kit
MBS8410884-02 5x 1 Kit

Human Endothelin 1 ELISA Kit

Sign In for Pricing
View Details