Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAM Peptide - N-terminal region

STAM Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686J2352, STAM1, STAM-1

UniProt

Q92783

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAM Rabbit Polyclonal Antibody (orb585528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003464

Preservative

Lyophilized powder

AA Sequence

EQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABRD ORF Vector (Human) (pORF)
ORF004265 1.0 µg DNA

GABRD ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Influenza A virus (H7N9) NF (CsgA) -3M2e Protein, N-His
VK736062-01 50 µg

Recombinant Influenza A virus (H7N9) NF (CsgA) -3M2e Protein, N-His

Sign In for Pricing
View Details
Recombinant Influenza A virus (H7N9) NF (CsgA) -3M2e Protein, N-His
VK736062-02 100 µg

Recombinant Influenza A virus (H7N9) NF (CsgA) -3M2e Protein, N-His

Sign In for Pricing
View Details
Recombinant Influenza A virus (H7N9) NF (CsgA) -3M2e Protein, N-His
VK736062-03 1 mg

Recombinant Influenza A virus (H7N9) NF (CsgA) -3M2e Protein, N-His

Sign In for Pricing
View Details
HighFidelity AF555 PCR Labeling Kit
APP-101-AF555-S 10 Reactions x 20 µL

HighFidelity AF555 PCR Labeling Kit

Sign In for Pricing
View Details
Tcte3 siRNA Oligos set (Mouse)
46427174 3x 5 nmol

Tcte3 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details