Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STARD4 Peptide - middle region

STARD4 Peptide - middle region

Product Specifications

UniProt

Q96DR4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STARD4 Rabbit Polyclonal Antibody (orb581793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631903

Preservative

Lyophilized powder

AA Sequence

EYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(2-Aminoethyl)-3',6'-bis(diethylamino)spiro[isoindoline-1,9'-xanthen]-3-one (>80%)
TRC-A622790-50MG 50 mg

2-(2-Aminoethyl)-3',6'-bis(diethylamino)spiro[isoindoline-1,9'-xanthen]-3-one (>80%)

Sign In for Pricing
View Details
C3ar1 Mouse Gene Knockout Kit (CRISPR)
KN302378LP 1 Kit

C3ar1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), 0.2mg/mL
BNUB1856-500 1x 500 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), 0.2mg/mL

Sign In for Pricing
View Details
Human KRTAP5-2 activation kit by CRISPRa
GA118427 1 Kit

Human KRTAP5-2 activation kit by CRISPRa

Sign In for Pricing
View Details
CYP4X1 (N-term) Rabbit Polyclonal Antibody
AP14736PU-N 400 µL

CYP4X1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Phenyloxolan-2-one
TRC-P321518-50MG 50 mg

4-Phenyloxolan-2-one

Sign In for Pricing
View Details