Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STARD4 Peptide - middle region

STARD4 Peptide - middle region

Product Specifications

UniProt

Q96DR4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STARD4 Rabbit Polyclonal Antibody (orb581793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631903

Preservative

Lyophilized powder

AA Sequence

EYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF488A conjugate, 0.1mg/mL
BNC882571-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fructose Valine (mixture of diastereomers)
TRC-F792595-10MG 10 mg

Fructose Valine (mixture of diastereomers)

Sign In for Pricing
View Details
4-Bromobiphenyl
TRC-B680545-25G 25 g

4-Bromobiphenyl

Sign In for Pricing
View Details
UFC1 Rabbit Monoclonal Antibody
TA423409 100 µL

UFC1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SHISAL1 Human Gene Knockout Kit (CRISPR)
KN419322 1 Kit

SHISAL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR560716 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details