Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stat5b Peptide - C-terminal region

Stat5b Peptide - C-terminal region

Product Specifications

UniProt

P42232

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stat5b Rabbit Polyclonal Antibody (orb576221) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_035619

Preservative

Lyophilized powder

AA Sequence

PVVCPQAHYNMYPPNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yes1 Recombinant Rabbit Monoclonal Antibody [JE37-26]
HA721563 100 µL

Yes1 Recombinant Rabbit Monoclonal Antibody [JE37-26]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD45.2 Antibody[104.2]
E-AB-F1122UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD45.2 Antibody[104.2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD45.2 Antibody[104.2]
E-AB-F1122UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD45.2 Antibody[104.2]

Sign In for Pricing
View Details
HHAT (NM_018194) Human Recombinant Protein
TP308447 20 µg

HHAT (NM_018194) Human Recombinant Protein

Sign In for Pricing
View Details
DMRTA1 (C-term) Rabbit Polyclonal Antibody
AP51280PU-N 400 µL

DMRTA1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bax (BAX/962), CF640R conjugate, 0.1mg/mL
BNC400962-500 1x 500 µL

Bax (BAX/962), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details