Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP1 Peptide - N-terminal region

STEAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC19484, PRSS24, STEAP

UniProt

Q9UHE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STEAP1 Rabbit Polyclonal Antibody (orb576077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036581

Preservative

Lyophilized powder

AA Sequence

FYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor X (F10) (NM_000504) Human Over-expression Lysate
LY400172 100 µg

Factor X (F10) (NM_000504) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclin B1 (V92.1), 0.2mg/mL
BNUB0680-100 1x 100 µL

Cyclin B1 (V92.1), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant SIRT2 Monoclonal Antibody
AN301727L-01 50 µL

Recombinant SIRT2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SIRT2 Monoclonal Antibody
AN301727L-02 100 µL

Recombinant SIRT2 Monoclonal Antibody

Sign In for Pricing
View Details
Twinkle (TWNK) (NM_001163812) Human Over-expression Lysate
LY431501 100 µg

Twinkle (TWNK) (NM_001163812) Human Over-expression Lysate

Sign In for Pricing
View Details
TXNIP Mouse Monoclonal Antibody [Clone ID: JY1]
AM20295AF-N 100 µg

TXNIP Mouse Monoclonal Antibody [Clone ID: JY1]

Sign In for Pricing
View Details