Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP1 Peptide - N-terminal region

STEAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC19484, PRSS24, STEAP

UniProt

Q9UHE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STEAP1 Rabbit Polyclonal Antibody (orb576077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036581

Preservative

Lyophilized powder

AA Sequence

FYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rprd1b Mouse Gene Knockout Kit (CRISPR)
KN515073 1 Kit

Rprd1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Phospho-S6 Ribosomal Protein (Ser235, 236) Monoclonal Antibody
AN300373L-01 20 µL

Recombinant Phospho-S6 Ribosomal Protein (Ser235, 236) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Phospho-S6 Ribosomal Protein (Ser235, 236) Monoclonal Antibody
AN300373L-02 100 µL

Recombinant Phospho-S6 Ribosomal Protein (Ser235, 236) Monoclonal Antibody

Sign In for Pricing
View Details
AFP Polyclonal Antibody
E-AB-13768-01 20 µL

AFP Polyclonal Antibody

Sign In for Pricing
View Details
AFP Polyclonal Antibody
E-AB-13768-02 60 µL

AFP Polyclonal Antibody

Sign In for Pricing
View Details
AFP Polyclonal Antibody
E-AB-13768-03 120 µL

AFP Polyclonal Antibody

Sign In for Pricing
View Details