Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK11 Peptide - C-terminal region

STK11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LKB1, PJS, hLKB1

UniProt

Q15831

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK11 Rabbit Polyclonal Antibody (orb584178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000446

Preservative

Lyophilized powder

AA Sequence

EAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pure Lens culinaris Lectin (Lentil) -LcH-
L-1401-25 25 mg

Pure Lens culinaris Lectin (Lentil) -LcH-

Sign In for Pricing
View Details
Griffonia simplicifolia Gel -GS-II- Immobilized Lectin
A-2402-2 2 mL

Griffonia simplicifolia Gel -GS-II- Immobilized Lectin

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS706409 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), 0.2mg/mL
BNUB2897-500 1x 500 µL

Major Vault Protein (MVP) (VP2897R), 0.2mg/mL

Sign In for Pricing
View Details
VGLL1 Human Gene Knockout Kit (CRISPR)
KN200600LP 1 Kit

VGLL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Streptococcus agalactiae TaqMan PCR Kit
TM30650 100 Reactions

Streptococcus agalactiae TaqMan PCR Kit

Sign In for Pricing
View Details