Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stk25 Peptide - C-terminal region

Stk25 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC94619, Stk25

UniProt

Q6V9V9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stk25 Rabbit Polyclonal Antibody (orb330564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_908938

Preservative

Lyophilized powder

AA Sequence

TKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ferrochelatase (FECH) ELISA Kit
abx251425 96 Well

Human Ferrochelatase (FECH) ELISA Kit

Sign In for Pricing
View Details
RPL13A Antibody, FITC conjugated
A41097-100UG 100 µg

RPL13A Antibody, FITC conjugated

Sign In for Pricing
View Details
Clk3 Mouse shRNA Plasmid (Locus ID 102414)
TR515153 1 Kit

Clk3 Mouse shRNA Plasmid (Locus ID 102414)

Sign In for Pricing
View Details
PPP4R3C Human qPCR Primer Pair (NM_207319)
HP219642 200 Reactions

PPP4R3C Human qPCR Primer Pair (NM_207319)

Sign In for Pricing
View Details
Recombinant Solanum bulbocastanum Photosystem II CP47 chlorophyll apoprotein (psbB)
MBS7027435-01 0.02 mg

Recombinant Solanum bulbocastanum Photosystem II CP47 chlorophyll apoprotein (psbB)

Sign In for Pricing
View Details
Recombinant Solanum bulbocastanum Photosystem II CP47 chlorophyll apoprotein (psbB)
MBS7027435-02 0.1 mg

Recombinant Solanum bulbocastanum Photosystem II CP47 chlorophyll apoprotein (psbB)

Sign In for Pricing
View Details