Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stk25 Peptide - C-terminal region

Stk25 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC94619, Stk25

UniProt

Q6V9V9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stk25 Rabbit Polyclonal Antibody (orb330564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_908938

Preservative

Lyophilized powder

AA Sequence

TKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Gal-7 / Galectin-7, Animal Free & Carrier Free
C-CYP367-20ug 20 µg

Recombinant Human Gal-7 / Galectin-7, Animal Free & Carrier Free

Sign In for Pricing
View Details
WAY 181187 25mg
A14163-25 25 mg

WAY 181187 25mg

Sign In for Pricing
View Details
4833439L19Rik (NM_133797) Mouse Untagged Clone
MC212024 10 µg

4833439L19Rik (NM_133797) Mouse Untagged Clone

Sign In for Pricing
View Details
RFTN2 Blocking Peptide
33R-6014 0.1 mg

RFTN2 Blocking Peptide

Sign In for Pricing
View Details
Mouse Monoclonal 5'-Nucleotidase/CD73 Antibody (45M4F9)
NBP2-25237 0.1 mg

Mouse Monoclonal 5'-Nucleotidase/CD73 Antibody (45M4F9)

Sign In for Pricing
View Details
ACAT2 siRNA (Human)
CRH0031-01 15 nmol

ACAT2 siRNA (Human)

Sign In for Pricing
View Details