Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK38L Peptide - middle region

STK38L Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0965, NDR2

UniProt

Q9Y2H1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK38L Rabbit Polyclonal Antibody (orb582649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055815

Preservative

Lyophilized powder

AA Sequence

PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MIS RII Protein, Fc Tag
MII-H5258-1mg 1 mg

Human MIS RII Protein, Fc Tag

Sign In for Pricing
View Details
Anti-CARD4/NOD1 Antibody Picoband® Fluoro488 Conjugated
A00495-1-Fluoro488 100 µg/Vial

Anti-CARD4/NOD1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
HGD (C-5) : m-IgG2a BP-HRP Bundle
sc-546485 1 Kit

HGD (C-5) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
GGPS1 Rabbit Polyclonal Antibody
orb666766-01 30 µL

GGPS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GGPS1 Rabbit Polyclonal Antibody
orb666766-02 50 μL

GGPS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GGPS1 Rabbit Polyclonal Antibody
orb666766-03 100 µL

GGPS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details