Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK38L Peptide - middle region

STK38L Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0965, NDR2

UniProt

Q9Y2H1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK38L Rabbit Polyclonal Antibody (orb582649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055815

Preservative

Lyophilized powder

AA Sequence

PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr90 (NM_001163766) Mouse Tagged ORF Clone
MG216946 10 µg

Wdr90 (NM_001163766) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PLA2G4D (NM_178034) Human Tagged ORF Clone
RC222969 10 µg

PLA2G4D (NM_178034) Human Tagged ORF Clone

Sign In for Pricing
View Details
Porcine Cerebellin 2 (CBLN2) ELISA kit
GTR10430903 96 Well

Porcine Cerebellin 2 (CBLN2) ELISA kit

Sign In for Pricing
View Details
ILVBL Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1573410 100 µL

ILVBL Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details
Bovine Spermidine Synthase (SRM) ELISA Kit
MBS9380983-01 48 Well

Bovine Spermidine Synthase (SRM) ELISA Kit

Sign In for Pricing
View Details
Bovine Spermidine Synthase (SRM) ELISA Kit
MBS9380983-02 96 Well

Bovine Spermidine Synthase (SRM) ELISA Kit

Sign In for Pricing
View Details