Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STOM Peptide - C-terminal region

STOM Peptide - C-terminal region

Product Specifications

Product Name Alternative

BND7, EPB7, EPB72

UniProt

P27105

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STOM Rabbit Polyclonal Antibody (orb585015) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_004090

Preservative

Lyophilized powder

AA Sequence

LQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT5 (NM_006388) Human Over-expression Lysate
LC401920 20 µg

KAT5 (NM_006388) Human Over-expression Lysate

Sign In for Pricing
View Details
TissueScan, Prostate Cancer cDNA Array I
HPRT501 10 Panels

TissueScan, Prostate Cancer cDNA Array I

Sign In for Pricing
View Details
CXCR2 (NM_001557) Human Over-expression Lysate
LY400595 100 µg

CXCR2 (NM_001557) Human Over-expression Lysate

Sign In for Pricing
View Details
GLEPP1 (PTPRO) (NM_030671) Human Recombinant Protein
TP320785 20 µg

GLEPP1 (PTPRO) (NM_030671) Human Recombinant Protein

Sign In for Pricing
View Details
PRMT5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C12]
TA807463AM 100 µL

PRMT5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C12]

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2956), Biotin conjugate, 0.1mg/mL
BNCB2956-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2956), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details