Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STOML2 Peptide - C-terminal region

STOML2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSPC108, SLP-2

UniProt

Q9UJZ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STOML2 Rabbit Polyclonal Antibody (orb585120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038470

Preservative

Lyophilized powder

AA Sequence

VTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUCA1 Polyclonal Antibody
E-AB-15050-01 20 µL

FUCA1 Polyclonal Antibody

Sign In for Pricing
View Details
FUCA1 Polyclonal Antibody
E-AB-15050-02 60 µL

FUCA1 Polyclonal Antibody

Sign In for Pricing
View Details
FUCA1 Polyclonal Antibody
E-AB-15050-03 120 µL

FUCA1 Polyclonal Antibody

Sign In for Pricing
View Details
FUCA1 Polyclonal Antibody
E-AB-15050-04 200 µL

FUCA1 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS627552 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
PDE8A Rabbit Polyclonal Antibody
TA379741 100 µL

PDE8A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details